Producto para uso experimental en laboratorio. No es medicamento ni producto de consumo humano.
Research use only. This content is for laboratory research; not for human or veterinary use, diagnosis, or treatment.
What TB-500 is (and isn't)
Two things are worth separating, because the market routinely conflates them. Thymosin β4 (Tβ4) is an endogenous 43-amino-acid peptide (N-acetylated sequence SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES), molecular weight ~4921 Da, CAS number 77591-33-4. It is the principal G-actin-sequestering protein in eukaryotic cells [1]. "TB-500", by contrast, is a trade name that in research practice usually denotes a synthetic fragment containing the actin-binding domain of Tβ4 (around the LKKTET motif) rather than the full-length protein.
The distinction matters when reading the literature: the overwhelming majority of peer-reviewed studies used full-length Thymosin β4, not the fragment marketed as TB-500. Extrapolating Tβ4 findings to the fragment assumes the actin-binding domain reproduces the whole molecule's full range of activities — something the evidence bears out only in part.
Documented mechanism of action
Tβ4's most thoroughly characterised mechanism is the sequestration of monomeric actin (G-actin). By binding free actin monomers it regulates the equilibrium between G-actin and F-actin (polymerised), a central control of cell motility and shape. The LKKTET motif mediates this binding [1].
Beyond its cytoskeletal role, preclinical evidence describes extracellular functions. In cardiomyocytes, Tβ4 formed a functional complex with PINCH and integrin-linked kinase (ILK), which activated the Akt survival pathway; after coronary artery ligation in mice, Tβ4 treatment was associated with greater myocyte survival and improved cardiac function in the model [2]. These data place Tβ4 at the intersection of cell migration, survival and repair signalling.
What the research studies show
The peer-reviewed literature documents the following findings in experimental models:
- In a full-thickness wound model in rats, topical or intraperitoneal Tβ4 accelerated re-epithelialisation by 42% over saline controls at day 4, and by up to 61% at day 7, with greater collagen deposition and angiogenesis in treated tissue [3].
- In cardiomyocytes and a murine infarction model, Tβ4 promoted cell migration and survival via ILK/Akt activation, with improved cardiac function in the experimental model [2].
- As the predominant G-actin-sequestering protein in the cell, Tβ4 regulated the G-actin/F-actin equilibrium, the biochemical basis of its effects on cell motility and shape [1].
Limitations of the current evidence
Most data come from animal models and cell culture using full-length Thymosin β4. The pharmacological equivalence between full-length Tβ4 and the fragment marketed as TB-500 is not established in the peer-reviewed literature, and pharmacokinetic characterisation of the fragment is sparse.
No efficacy trials back human uses, and the administration routes, stability and doses used in rodents have not been validated by cross-species extrapolation. The angiogenic effects observed, while relevant to repair, call for interpretive caution: angiogenesis is a double-edged process whose balance depends on tissue context.
Considerations for research protocols
For reproducible research, molecular identity is the first control: a protocol citing "TB-500" should state whether the material is full-length Thymosin β4 or a fragment, because interpretation of the results depends on it. The batch Certificate of Analysis (COA) should declare the target sequence or molecular weight by mass spectrometry, so it is possible to confirm which of the two molecules is in use.
Documentation and traceability
MX-1 Labs holds to a COA per batch for every peptide: purity by HPLC (≥98%), identity confirmed by mass spectrometry against the target molecular weight, amino-acid analysis, water content by Karl Fischer and endotoxin testing by LAL. For peptides with ambiguous trade names such as TB-500, that same COA is what lets you verify which molecule the vial actually contains and cite the material precisely in a publication.
References
- [[1]] Goldstein AL, Hannappel E, Kleinman HK. Thymosin beta4: actin-sequestering protein moonlights to repair injured tissues. Trends Mol Med. 2005;11(9):421-429. PubMed
- [[2]] Bock-Marquette I, Saxena A, White MD, et al. Thymosin beta4 activates integrin-linked kinase and promotes cardiac cell migration, survival and cardiac repair. Nature. 2004;432(7016):466-472. PubMed
- [[3]] Malinda KM, Sidhu GS, Mani H, et al. Thymosin beta4 accelerates wound healing. J Invest Dermatol. 1999;113(3):364-368. PubMed
Related reading
- Science
Ozempic, Wegovy, and Mounjaro: the differences between the brands
Which molecule sits behind each brand, how the mechanisms differ, and the line between the approved medicine and the research compound.
Published 2026-08-13
Read → - Science
Mounjaro (Tirzepatide): what it is and what the research shows
The difference between the approved medicine Mounjaro® and tirzepatide (LY3298176) for research, the dual GIP/GLP-1 mechanism, and what the literature shows.
Published 2026-08-11
Read → - Science
CJC-1295: long-acting GHRH analog in research
What CJC-1295 is, how the DAC and non-DAC variants differ, and what the literature documents on GH and IGF-I stimulation in research models.
Published 2026-08-08
Read →