TB-500 and Thymosin β4: the tissue-repair peptide in research

Producto para uso experimental en laboratorio. No es medicamento ni producto de consumo humano.

Research use only. This content is for laboratory research; not for human or veterinary use, diagnosis, or treatment.

What TB-500 is (and isn't)

Two things are worth separating, because the market routinely conflates them. Thymosin β4 (Tβ4) is an endogenous 43-amino-acid peptide (N-acetylated sequence SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES), molecular weight ~4921 Da, CAS number 77591-33-4. It is the principal G-actin-sequestering protein in eukaryotic cells ^[1]. "TB-500", by contrast, is a trade name that in research practice usually denotes a synthetic fragment containing the actin-binding domain of Tβ4 (around the LKKTET motif) rather than the full-length protein.

The distinction matters when reading the literature: the overwhelming majority of peer-reviewed studies used full-length Thymosin β4, not the fragment marketed as TB-500. Extrapolating Tβ4 findings to the fragment assumes the actin-binding domain reproduces the whole molecule's full range of activities — something the evidence bears out only in part.

Documented mechanism of action

Tβ4's most thoroughly characterised mechanism is the sequestration of monomeric actin (G-actin). By binding free actin monomers it regulates the equilibrium between G-actin and F-actin (polymerised), a central control of cell motility and shape. The LKKTET motif mediates this binding ^[1].

Beyond its cytoskeletal role, preclinical evidence describes extracellular functions. In cardiomyocytes, Tβ4 formed a functional complex with PINCH and integrin-linked kinase (ILK), which activated the Akt survival pathway; after coronary artery ligation in mice, Tβ4 treatment was associated with greater myocyte survival and improved cardiac function in the model ^[2]. These data place Tβ4 at the intersection of cell migration, survival and repair signalling.

What the research studies show

The peer-reviewed literature documents the following findings in experimental models:

• In a full-thickness wound model in rats, topical or intraperitoneal Tβ4 accelerated re-epithelialisation by 42% over saline controls at day 4, and by up to 61% at day 7, with greater collagen deposition and angiogenesis in treated tissue ^[3].
• In cardiomyocytes and a murine infarction model, Tβ4 promoted cell migration and survival via ILK/Akt activation, with improved cardiac function in the experimental model ^[2].
• As the predominant G-actin-sequestering protein in the cell, Tβ4 regulated the G-actin/F-actin equilibrium, the biochemical basis of its effects on cell motility and shape ^[1].

Limitations of the current evidence

Most data come from animal models and cell culture using full-length Thymosin β4. The pharmacological equivalence between full-length Tβ4 and the fragment marketed as TB-500 is not established in the peer-reviewed literature, and pharmacokinetic characterisation of the fragment is sparse.

No efficacy trials back human uses, and the administration routes, stability and doses used in rodents have not been validated by cross-species extrapolation. The angiogenic effects observed, while relevant to repair, call for interpretive caution: angiogenesis is a double-edged process whose balance depends on tissue context.

Considerations for research protocols

For reproducible research, molecular identity is the first control: a protocol citing "TB-500" should state whether the material is full-length Thymosin β4 or a fragment, because interpretation of the results depends on it. The batch Certificate of Analysis (COA) should declare the target sequence or molecular weight by mass spectrometry, so it is possible to confirm which of the two molecules is in use.

Documentation and traceability

MX-1 Labs holds to a COA per batch for every peptide: purity by HPLC (≥98%), identity confirmed by mass spectrometry against the target molecular weight, amino-acid analysis, water content by Karl Fischer and endotoxin testing by LAL. For peptides with ambiguous trade names such as TB-500, that same COA is what lets you verify which molecule the vial actually contains and cite the material precisely in a publication.